Carboxylesterase 1C, Mouse (P.pastoris, His)
Carboxylesterase 1C, Mouse (P.pastoris, His)
SKU:QM-0204166-01
Couldn't load pickup availability
Request quote or documents

Product Details
-
Description
The carboxylesterase 1C protein is essential for xenobiotic detoxification and ester/amide prodrug activation, as well as participating in extracellular metabolism. Its multifunctional effects include processing of pulmonary surfactant. Carboxylesterase 1C Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Carboxylesterase 1C protein, expressed by P. pastoris , with N-6*His labeled tag.
-
Molecular Formula
13884 (Gene_ID) P23953 (H19-H550) (Accession)
-
Smiles
HSLLPPVVDTTQGKVLGKYISLEGFEQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNATSYPPMCSQDAGWAKILSDMFSTEKEILPLKISEDCLYLNIYSPADLTKSSQLPVMVWIHGGGLVIGGASPYNGLALSAHENVVVVTIQYRLGIWGLFSTGDEHSPGNWAHLDQLAALRWVQDNIANFGGNPDSVTIFGESSGGISVSVLVLSPLGKDLFHRAISESGVVINTNVGKKNIQAVNEIIATLSQCNDTSSAAMVQCLRQKTESELLEISGKLVQYNISLSTMIDGVVLPKAPEEILAEKSFNTVPYIVGFNKQEFGWIIPMMLQNLLPEGKMNEETASLLLRRFHSELNISESMIPAVIEQYLRGVDDPAKKSELILDMFGDIFFGIPAVLLSRSLRDAGVSTYMYEFRYRPSFVSDKRPQTVEGDHGDEIFFVFGAPLLKEGASEEETNLSKMVMKFWANFARNGNPNGEGLPHWPEYDEQEGYLQIGATTQQAQRLKAEEVAFWTELLAKNPPETDPTEH
-
Purity
98
-
Storage Conditions
Stored at -20°C for 2 years
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
- QM-0054453-01 Δ9-Tetrahydrocannabinolic acid [CAS 23978-85-0]
- QM-0053803 γ-Linolenic acid ethyl ester-d5
- QM-0052686-01 β-Phenyl GHB (sodium) [CAS 40951-19-7]
- QM-0051720-01 β-Phenylethyl β-D-glucoside [CAS 18997-54-1]
- QM-0049152-01 β-keto Phentermine (hydrochloride) [CAS 6946-08-3]
- QM-0048489-01 β-N-methylamino-L-alanine (hydrochloride) (Standard) [CAS 16012-55-8]
- QM-0022874 β-Prumycin hydrochloride [CAS 54612-74-7]
- QM-0008481-01 β-Methoxy 2C-B (hydrochloride) [CAS 98537-39-4]
- QM-0005999-01 β-Muricholic acid (Standard) [CAS 2393-59-1]
- QM-0161998-01 γ-Aminobutyric acid (Standard) [CAS 56-12-2]
Other industry favorites
- QM-0054453-01 Δ9-Tetrahydrocannabinolic acid [CAS 23978-85-0]
- QM-0053803 γ-Linolenic acid ethyl ester-d5
- QM-0143709-01 γ-Acetylenic GABA (hydrochloride) [CAS 103451-26-9]
- QM-0178574-01 β-Sitosterol acetate, 40% (contains Campesterol acetate) [CAS 915-05-9]
- QM-0061106-01 γ-D-Glutamylaminomethylsulfonic acid [CAS 90237-02-8]
- QM-0090052 β-Peltoboykinolic acid [CAS 24778-48-1]
- QM-0161999-01 γ-Aminobutyric acid-d6 [CAS 70607-85-1]
- QM-0162002-01 γ-Aminobutyric acid-13C4
- QM-0111443-01 β-Methylcholine (chloride) [CAS 2382-43-6]
- QM-0067514 γ-Secretase modulator 11 (hydrochloride) [CAS 2434630-30-3]
Carboxylesterase 1C, Mouse (P.pastoris, His)
Carboxylesterase 1C, Mouse (P.pastoris, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.