Citrate Synthase/CS, Human (sf9, His)
Citrate Synthase/CS, Human (sf9, His)
SKU:QM-0183092-01
Couldn't load pickup availability
Request quote or documents
Product Details
-
Description
Citrate synthase (CS) is a key enzyme in carbohydrate metabolism, especially in the tricarboxylic acid (TCA) cycle, where it catalyzes the conversion of oxaloacetate and acetyl-CoA into citric acid. This enzymatic process represents the first and critical step in the TCA cycle, which is the basis of cellular energy production. Citrate Synthase/CS Protein, Human (sf9, His) is the recombinant human-derived Citrate Synthase/CS protein, expressed by Sf9 insect cells , with C-His labeled tag.
-
Molecular Formula
1431 (Gene_ID) O75390 (A28-G466) (Accession)
-
Smiles
ASSTNLKDILADLIPKEQARIKTFRQQHGKTVVGQITVDMMYGGMRGMKGLVYETSVLDPDEGIRFRGFSIPECQKLLPKAKGGEEPLPEGLFWLLVTGHIPTEEQVSWLSKEWAKRAALPSHVVTMLDNFPTNLHPMSQLSAAVTALNSESNFARAYAQGISRTKYWELIYEDSMDLIAKLPCVAAKIYRNLYREGSGIGAIDSNLDWSHNFTNMLGYTDHQFTELTRLYLTIHSDHEGGNVSAHTSHLVGSALSDPYLSFAAAMNGLAGPLHGLANQEVLVWLTQLQKEVGKDVSDEKLRDYIWNTLNSGRVVPGYGHAVLRKTDPRYTCQREFALKHLPNDPMFKLVAQLYKIVPNVLLEQGKAKNPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTEGLMKFVDSKSG
-
Purity
90
-
Storage Conditions
Stored at -20°C for 2 years
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
- QM-0047852-01 [1,4-Bis (diphenylphosphino) butane] (norbornadiene) rhodium (tetrafluoroborate) [CAS 82499-43-2]
- QM-0019909 [ (2R) -3,3,4-Trimethyl-6-oxo-3,6-dihydro-1H-pyran-2-yl]acetyl-CoA
- QM-0019908 [ (1R) -2,2,3-Trimethyl-5-oxocyclopent-3-enyl]acetyl-CoA
- QM-0006765 Zastaprazan (citrate) [CAS 2936619-43-9]
- QM-0005481-01 α-D-Glucose-1-phosphate (disodium) (Standard) [CAS 56401-20-8]
- QM-0003778 α-D-Glucose 1,6-bisphosphate [CAS 10139-18-1]
- QM-0142551-01 α-D-Glucose-1-phosphate (disodium hydrate) [CAS 230954-92-4]
- QM-0144731 α, β-Methylene-ATP (dilithium) [CAS 104809-20-3]
- QM-0142550-01 α-D-Glucose-1-phosphate (disodium) [CAS 56401-20-8]
- QM-0159950-01 Zuclomiphene (citrate) [CAS 7619-53-6]
Other industry favorites
- QM-0047852-01 [1,4-Bis (diphenylphosphino) butane] (norbornadiene) rhodium (tetrafluoroborate) [CAS 82499-43-2]
- QM-0019909 [ (2R) -3,3,4-Trimethyl-6-oxo-3,6-dihydro-1H-pyran-2-yl]acetyl-CoA
- QM-0125036 γ- (6-Aminohexyl) -ATP-biotin [CAS 1705572-09-3]
- QM-0062472 α, β-Methylene-ATP [CAS 7292-42-4]
- QM-0040271 Tcap Mouse Pre-designed siRNA Set A
- QM-0024997 TFE-IDAtp1-LinA
- QM-0159951-01 Zuclomiphene-d4 (citrate) [CAS 2714316-71-7]
- QM-0166346 α-D-Glucose pentaacetate (Standard) [CAS 604-68-2]
- QM-0082763 Zuclomiphene d10 Citrate salt
- QM-0054395 Trans-2, cis-6-Nonadienal-d5
Citrate Synthase/CS, Human (sf9, His)
Citrate Synthase/CS, Human (sf9, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.