Skip to product information
1 of 1

Cystatin-8/CST8, Human (HEK293, Fc)

Cystatin-8/CST8, Human (HEK293, Fc)

Size

SKU:QM-0203862-01

£62.26 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Cystatin-8/CST8 Protein specializes in sperm development and maturation. Cystatin-8/CST8 Protein, Human (HEK293, Fc) is the recombinant human-derived Cystatin-8/CST8 protein, expressed by HEK293 , with C-hFc labeled tag.

  • Molecular Formula

    10047 (Gene_ID) O60676 (K22-A142) (Accession)

  • Smiles

    KDPKKNETGVLRKLKPVNASNANVKQCLWFAMQEYNKESEDKYVFLVVKTLQAQLQVTNLLEYLIDVEIARSDCRKPLSTNEICAIQENSKLKRKLSCSFLVGALPWNGEFTVMEKKCEDA

  • Purity

    90

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0203862-01
5 µgQM-0203862-01
£62.26/ea
£0.00
£62.26/ea £0.00
10 µgQM-0203862-02
10 µgQM-0203862-02
£97.00/ea
£0.00
£97.00/ea £0.00
50 µgQM-0203862-03
50 µgQM-0203862-03
£271.13/ea
£0.00
£271.13/ea £0.00
100 µgQM-0203862-04
100 µgQM-0203862-04
£426.65/ea
£0.00
£426.65/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Cystatin-8/CST8, Human (HEK293, Fc)

Cystatin-8/CST8, Human (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.