Skip to product information
1 of 1

Cystatin A/CSTA, Human (His)

Cystatin A/CSTA, Human (His)

Size

SKU:QM-0176636-01

£117.25 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Cystatin A (CSTA) protein is an intracellular thiol protease inhibitor critical for desmosome-mediated intercellular adhesion, especially in the epidermis. Its role as a protease inhibitor is essential for regulating cellular proteolytic activity. Cystatin A/CSTA Protein, Human (His) is the recombinant human-derived Cystatin A/CSTA protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    1475 (Gene_ID) P01040 (I2-F98) (Accession)

  • Smiles

    IPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0176636-01
10 µgQM-0176636-01
£117.25/ea
£0.00
£117.25/ea £0.00
50 µgQM-0176636-02
50 µgQM-0176636-02
£348.89/ea
£0.00
£348.89/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Cystatin A/CSTA, Human (His)

Cystatin A/CSTA, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.