Cystatin B/CSTB, Mouse (His)
Cystatin B/CSTB, Mouse (His)
SKU:QM-0084254
Request quote or documents
Product Details
-
Description
Cystatin B/CSTB Protein, an intracellular thiol proteinase inhibitor, crucially regulates proteolytic activities within the cell. By inhibiting thiol proteinases, Cystatin B maintains the balance of proteolytic processes, emphasizing its significance in cellular homeostasis. Its inhibitory function underscores involvement in cellular processes requiring precise regulation of proteolytic activity for normal cellular function and integrity. Cystatin B/CSTB Protein, Mouse (His) is the recombinant mouse-derived Cystatin B/CSTB protein, expressed by E. coli , with N-6*His labeled tag.
-
Molecular Formula
13014 (Gene_ID) Q62426 (M1-F98) (Accession)
-
Smiles
MMCGAPSATMPATAETQEVADQVKSQLESKENQKFDVFKAISFKRQIVAGTNLFIKVDVGGDKCVHLRVFQPLPHENKPLTLSSYQTNKERHDELSYF
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
- QM-0015916 Wee1/HDAC-IN-1 [CAS 3037071-29-4]
- QM-0013795-01 Vizenpistat [CAS 2687222-58-6]
- QM-0008932 VEGFR-IN-7 [CAS 683235-33-8]
- QM-0008931 VEGFR-IN-6 [CAS 683235-34-9]
- QM-0008885 VEGFR/PDGFR-IN-1 [CAS 342785-98-2]
- QM-0008364-01 Verubecestat (Standard) [CAS 1286770-55-5]
- QM-0007272 Zavondemstat (sodium) [CAS 2908753-07-9]
- QM-0002491-01 Ziritaxestat (Standard) [CAS 1628260-79-6]
- QM-0002017 Zabadinostat (Standard) [CAS 934828-12-3]
- QM-0079654-01 Zabadinostat [CAS 934828-12-3]
Other industry favorites
- QM-0015916 Wee1/HDAC-IN-1 [CAS 3037071-29-4]
- QM-0013795-01 Vizenpistat [CAS 2687222-58-6]
- QM-0154836-01 Verdiperstat [CAS 890655-80-8]
- QM-0142135-01 Virstatin [CAS 88909-96-0]
- QM-0081849-01 Vorinostat (Standard) [CAS 149647-78-9]
- QM-0070505 VEGFR2-IN-3 [CAS 417717-09-0]
- QM-0081529-01 Ziritaxestat [CAS 1628260-79-6]
- QM-0205620-01 VEGFR-3/FLT4, Mouse (HEK293, hFc)
- QM-0178627-01 VinylMyristate (stabilizedwithMEHQ) [CAS 5809-91-6]
- QM-0175073-01 [Nle8] Somatostatin (1-28) (TFA)
Cystatin B/CSTB, Mouse (His)
Cystatin B/CSTB, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.