1 1

Cystatin C/CST3, Human (HEK293)

Cystatin C/CST3, Human (HEK293)

Size

QM-0189335-01

£111.63 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    Cystatin C/CST3 protein can significantly inhibit cysteine proteases and locally regulate their enzymatic activity. It captures and binds free plasma hemoglobin, preventing kidney damage and supporting hepatic heme iron recycling. Cystatin C/CST3 Protein, Human (HEK293) is the recombinant human-derived Cystatin C/CST3 protein, expressed by HEK293 , with tag free.

  • Molecular Formula

    1471 (Gene_ID) P01034 (S27-A146) (Accession)

  • Smiles

    SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA

  • Purity

    96

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
5 µgQM-0189335-01
5 µgQM-0189335-01
£111.63/ea		 £0.00
£111.63/ea £0.00
10 µgQM-0189335-02
10 µgQM-0189335-02
£199.44/ea		 £0.00
£199.44/ea £0.00
50 µgQM-0189335-03
50 µgQM-0189335-03
£437.58/ea		 £0.00
£437.58/ea £0.00
100 µgQM-0189335-04
100 µgQM-0189335-04
£669.65/ea		 £0.00
£669.65/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

Cystatin C/CST3, Human (HEK293)

Cystatin C/CST3, Human (HEK293) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.