Cystatin F/CST7, Mouse (HEK293, His)
Cystatin F/CST7, Mouse (HEK293, His)
SKU:QM-0172284-01
Couldn't load pickup availability
Request quote or documents
Product Details
-
Description
Cystatin F/CST7 Protein inhibits papain and cathepsin L, showing lower affinities compared to other cystatins. Notably, its distinct feature is its potential role in immune regulation, inhibiting a unique target within the hematopoietic system. This specialization implies Cystatin F/CST7's involvement in modulating immune responses within the complex regulatory network of hematopoiesis. Cystatin F/CST7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Cystatin F/CST7 protein, expressed by HEK293 , with C-6*His labeled tag.
-
Molecular Formula
13011 (Gene_ID) O89098 (A19-Q144) (Accession)
-
Smiles
ARPPDFCSKDLISSVKPGFPKTIETNNPGVLKAARHSVEKFNNCTNDIFLFKESHVSKALVQVVKGLKYMLEVKIGRTTCRKTMHHQLDNCDFQTNPALKRTLYCYSEVWVIPWLHSFEVPVLLCQ
-
Purity
98
-
Storage Conditions
Stored at -80°C for 1 year
-
Shipping Conditions
Dry ice.
Related Products
- QM-0015916 Wee1/HDAC-IN-1 [CAS 3037071-29-4]
- QM-0013795-01 Vizenpistat [CAS 2687222-58-6]
- QM-0008932 VEGFR-IN-7 [CAS 683235-33-8]
- QM-0008931 VEGFR-IN-6 [CAS 683235-34-9]
- QM-0008885 VEGFR/PDGFR-IN-1 [CAS 342785-98-2]
- QM-0008364-01 Verubecestat (Standard) [CAS 1286770-55-5]
- QM-0007272 Zavondemstat (sodium) [CAS 2908753-07-9]
- QM-0002491-01 Ziritaxestat (Standard) [CAS 1628260-79-6]
- QM-0002017 Zabadinostat (Standard) [CAS 934828-12-3]
- QM-0079654-01 Zabadinostat [CAS 934828-12-3]
Other industry favorites
- QM-0015916 Wee1/HDAC-IN-1 [CAS 3037071-29-4]
- QM-0013795-01 Vizenpistat [CAS 2687222-58-6]
- QM-0154836-01 Verdiperstat [CAS 890655-80-8]
- QM-0142135-01 Virstatin [CAS 88909-96-0]
- QM-0081849-01 Vorinostat (Standard) [CAS 149647-78-9]
- QM-0070505 VEGFR2-IN-3 [CAS 417717-09-0]
- QM-0081529-01 Ziritaxestat [CAS 1628260-79-6]
- QM-0205620-01 VEGFR-3/FLT4, Mouse (HEK293, hFc)
- QM-0178627-01 VinylMyristate (stabilizedwithMEHQ) [CAS 5809-91-6]
- QM-0175073-01 [Nle8] Somatostatin (1-28) (TFA)
Cystatin F/CST7, Mouse (HEK293, His)
Cystatin F/CST7, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.