1 1

Cystatin SN/CST1, Human (HEK293, His)

Cystatin SN/CST1, Human (HEK293, His)

Size

QM-0181440-01

£127.38 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    Cystatin SN (CST1) is a component of human saliva that is immunologically similar to cystatin S but exhibits distinct specificity due to sequence variation. Cystatin SN has an isoelectric point of 7.5 and is a potent inhibitor of papain and dipeptidyl peptidase I, superior to Cystatin S in these activities. Cystatin SN/CST1 Protein, Human (HEK293, His) is the recombinant human-derived Cystatin SN/CST1 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    1469 (Gene_ID) P01037 (W21-S141) (Accession)

  • Smiles

    WSPKEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQES

  • Purity

    97.3

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
5 µgQM-0181440-01
5 µgQM-0181440-01
£127.38/ea		 £0.00
£127.38/ea £0.00
10 µgQM-0181440-02
10 µgQM-0181440-02
£227.39/ea		 £0.00
£227.39/ea £0.00
50 µgQM-0181440-03
50 µgQM-0181440-03
£548.15/ea		 £0.00
£548.15/ea £0.00
100 µgQM-0181440-04
100 µgQM-0181440-04
£847.04/ea		 £0.00
£847.04/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

Cystatin SN/CST1, Human (HEK293, His)

Cystatin SN/CST1, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.