DUSP14, Human (His)
DUSP14, Human (His)
SKU:QM-0197415-01
Couldn't load pickup availability
Request quote or documents

Product Details
-
Description
DUSP14 protein can inactivate MAP kinase and dephosphorylate ERK, JNK and p38 MAP kinase. Its negative regulation extends to TCR signaling, where DUSP14 dephosphorylates the MAP3K7 adapter TAB1, resulting in inactivation. DUSP14 Protein, Human (His-MBP) is the recombinant human-derived DUSP14 protein, expressed by E. coli , with N-His labeled tag.
-
Molecular Formula
11072 (Gene_ID) O95147 (M1-H191) (Accession)
-
Smiles
MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRH
-
Purity
96
-
Storage Conditions
Stored at -20°C for 2 years
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
- QM-0004538-01 Zometapine [CAS 51022-73-2]
- QM-0206023-01 α-Demethylnaproxen [CAS 23981-47-7]
- QM-0151856-01 Ziapin 2 [CAS 2399497-60-8]
- QM-0127976 δ-Tocotrienol prodrug-1 [CAS 128254-90-0]
- QM-0127447-01 α-Demethylnaproxen (Standard) [CAS 23981-47-7]
- QM-0067858 Zicronapine [CAS 170381-16-5]
- QM-0059536 α-Hydroxytamoxifen [CAS 97151-02-5]
- QM-0067863 Zicronapine (fumarate) [CAS 170381-17-6]
- QM-0073738 Zoptarelin doxorubicin [CAS 139570-93-7]
- QM-0047346 Usp54 Rat Pre-designed siRNA Set A
Other industry favorites
- QM-0004538-01 Zometapine [CAS 51022-73-2]
- QM-0206023-01 α-Demethylnaproxen [CAS 23981-47-7]
- QM-0040834 Usp50 Mouse Pre-designed siRNA Set A
- QM-0039734 Usp48 Mouse Pre-designed siRNA Set A
- QM-0137353-01 USP7-IN-3 [CAS 2202738-42-7]
- QM-0149098-01 USP7-IN-9 [CAS 2444374-01-8]
- QM-0044176 Usp51 Rat Pre-designed siRNA Set A
- QM-0041331 Usp9x Rat Pre-designed siRNA Set A
- QM-0011868 USP7-IN-18 [CAS 3052223-40-9]
- QM-0011446-01 USP7 activator 1 [CAS 868940-26-5]
DUSP14, Human (His)
DUSP14, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.