1 1

DUSP14, Human (His)

DUSP14, Human (His)

Size

QM-0197415-01

£67.44 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    DUSP14 protein can inactivate MAP kinase and dephosphorylate ERK, JNK and p38 MAP kinase. Its negative regulation extends to TCR signaling, where DUSP14 dephosphorylates the MAP3K7 adapter TAB1, resulting in inactivation. DUSP14 Protein, Human (His-MBP) is the recombinant human-derived DUSP14 protein, expressed by E. coli , with N-His labeled tag.

  • Molecular Formula

    11072 (Gene_ID) O95147 (M1-H191) (Accession)

  • Smiles

    MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRH

  • Purity

    96

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
5 µgQM-0197415-01
5 µgQM-0197415-01
£67.44/ea		 £0.00
£67.44/ea £0.00
10 µgQM-0197415-02
10 µgQM-0197415-02
£101.50/ea		 £0.00
£101.50/ea £0.00
50 µgQM-0197415-03
50 µgQM-0197415-03
£282.06/ea		 £0.00
£282.06/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

DUSP14, Human (His)

DUSP14, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.