DUSP3, Human (His)
DUSP3, Human (His)
SKU:QM-0191285-01
Couldn't load pickup availability
Request quote or documents
Product Details
-
Description
DUSP3, a dual-specificity phosphatase, preferentially dephosphorylates phosphotyrosines. Its main function involves inactivating ERK1 and ERK2, thereby modulating associated cellular signaling pathways. DUSP3 Protein, Human (His) is the recombinant human-derived DUSP3 protein, expressed by E. coli , with N-6*His labeled tag.
-
Molecular Formula
1845 (Gene_ID) P51452-1 (S2-P185) (Accession)
-
Smiles
SGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP
-
Purity
97
-
Storage Conditions
Stored at -80°C for 1 year
-
Shipping Conditions
Dry ice
Related Products
- QM-0004538-01 Zometapine [CAS 51022-73-2]
- QM-0206023-01 α-Demethylnaproxen [CAS 23981-47-7]
- QM-0151856-01 Ziapin 2 [CAS 2399497-60-8]
- QM-0127976 δ-Tocotrienol prodrug-1 [CAS 128254-90-0]
- QM-0127447-01 α-Demethylnaproxen (Standard) [CAS 23981-47-7]
- QM-0067858 Zicronapine [CAS 170381-16-5]
- QM-0059536 α-Hydroxytamoxifen [CAS 97151-02-5]
- QM-0067863 Zicronapine (fumarate) [CAS 170381-17-6]
- QM-0073738 Zoptarelin doxorubicin [CAS 139570-93-7]
- QM-0047346 Usp54 Rat Pre-designed siRNA Set A
Other industry favorites
- QM-0004538-01 Zometapine [CAS 51022-73-2]
- QM-0206023-01 α-Demethylnaproxen [CAS 23981-47-7]
- QM-0040834 Usp50 Mouse Pre-designed siRNA Set A
- QM-0039734 Usp48 Mouse Pre-designed siRNA Set A
- QM-0137353-01 USP7-IN-3 [CAS 2202738-42-7]
- QM-0149098-01 USP7-IN-9 [CAS 2444374-01-8]
- QM-0044176 Usp51 Rat Pre-designed siRNA Set A
- QM-0041331 Usp9x Rat Pre-designed siRNA Set A
- QM-0011868 USP7-IN-18 [CAS 3052223-40-9]
- QM-0011446-01 USP7 activator 1 [CAS 868940-26-5]
DUSP3, Human (His)
DUSP3, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.