1 1

EFNB2A, zebrafish (HEK293, His)

EFNB2A, zebrafish (HEK293, His)

Size

QM-0205736-01

£58.12 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    The EFNB2A protein is a cell surface ligand of the Eph receptor that critically regulates migration, repulsion, and adhesion in neuronal, vascular, and epithelial development. EFNB2A Protein, zebrafish (HEK293, His) is the recombinant EFNB2A protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    30219 (Gene_ID) O73874 (L25-A222) (Accession)

  • Smiles

    LILDSIYWNTTNTKFVPGQGLVLYPQIGDKMDIVCPRVEGGSMEGVEYYKLYMVPLEQLKSCQVTKADTPLLNCVKPDQDVKFTLKFQEFSPNLWGLEFFRGKDYYIISTSNGTMEGLDNQEGGVCKTKSMKIIMKVGQNPSDPISPKDYPTSYPPKHPDLGGKDSKSNEVLKPDASPHGEDKGDGNKSSSVIGSEVA

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
2 µgQM-0205736-01
2 µgQM-0205736-01
£58.12/ea		 £0.00
£58.12/ea £0.00
10 µgQM-0205736-02
10 µgQM-0205736-02
£94.75/ea		 £0.00
£94.75/ea £0.00
50 µgQM-0205736-03
50 µgQM-0205736-03
£243.19/ea		 £0.00
£243.19/ea £0.00
100 µgQM-0205736-04
100 µgQM-0205736-04
£354.96/ea		 £0.00
£354.96/ea £0.00
500 µgQM-0205736-05
500 µgQM-0205736-05
£935.74/ea		 £0.00
£935.74/ea £0.00
1 mgQM-0205736-06
1 mgQM-0205736-06
£1,555.38/ea		 £0.00
£1,555.38/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

EFNB2A, zebrafish (HEK293, His)

EFNB2A, zebrafish (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.