Skip to product information
1 of 1

EGFR vIII, Human (HEK293, Fc)

EGFR vIII, Human (HEK293, Fc)

Size

SKU:QM-0188633-01

£143.13 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The EGFR vIII protein is a transmembrane glycoprotein in the protein kinase superfamily that acts as a receptor for epidermal growth factor. It acts on the cell surface, binds to epidermal growth factor, triggers receptor dimerization and tyrosine autophosphorylation, and promotes cell proliferation. EGFR vIII Protein, Human (HEK293, Fc) is the recombinant human-derived EGFR vIII protein, expressed by HEK293 , with C-hFc labeled tag.

  • Molecular Formula

    1956 (Gene_ID) NP_001333870 (L25-S378) (Accession)

  • Smiles

    LEEKKGNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPS

  • Purity

    97.06

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0188633-01
10 µgQM-0188633-01
£143.13/ea
£0.00
£143.13/ea £0.00
50 µgQM-0188633-02
50 µgQM-0188633-02
£404.78/ea
£0.00
£404.78/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

EGFR vIII, Human (HEK293, Fc)

EGFR vIII, Human (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.