1 1

Follistatin/FST, Human (HEK293, Fc)

Follistatin/FST, Human (HEK293, Fc)

Size

QM-0204128-01

£58.12 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    Follistatin (FST) is a regulator of TGFβ family signaling and acts by selectively binding to TGFβ family ligands and preventing ligand binding to the receptor complex. Follistatin has the ability to suppress the follicle stimulating hormone (FSH) [1][2]. Follistatin/FST Protein, Human (HEK293, Fc) is produced in HEK293 cells with a C-Terminal Fc-tag.

  • Molecular Formula

    10468 (Gene_ID) P19883-1/NP_037541.1 (G30-W344) (Accession)

  • Smiles

    GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
2 µgQM-0204128-01
2 µgQM-0204128-01
£58.12/ea		 £0.00
£58.12/ea £0.00
10 µgQM-0204128-02
10 µgQM-0204128-02
£109.38/ea		 £0.00
£109.38/ea £0.00
50 µgQM-0204128-03
50 µgQM-0204128-03
£305.15/ea		 £0.00
£305.15/ea £0.00
100 µgQM-0204128-04
100 µgQM-0204128-04
£481.32/ea		 £0.00
£481.32/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

Follistatin/FST, Human (HEK293, Fc)

Follistatin/FST, Human (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.