Skip to product information
1 of 1

Follistatin/FST, Mouse (HEK293, His)

Follistatin/FST, Mouse (HEK293, His)

Size

SKU:QM-0203473-01

£72.61 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Follistatin (FST) is a regulator of TGFβ family signaling and acts by selectively binding to TGFβ family ligands and preventing ligand binding to the receptor complex. Follistatin has the ability to suppress the follicle stimulating hormone (FSH) [1][2]. Follistatin/FST Protein, Mouse (HEK293, His) is produced in HEK293 cells with a C-Terminal 10*His-tag.

  • Molecular Formula

    14313 (Gene_ID) P47931-1 (G30-W344) (Accession)

  • Smiles

    GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPSSSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCGGGKKCLWDSKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEETEEEEEEEDQDYSFPISSILEW

  • Purity

    96.3

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0203473-01
2 µgQM-0203473-01
£72.61/ea
£0.00
£72.61/ea £0.00
10 µgQM-0203473-02
10 µgQM-0203473-02
£205.52/ea
£0.00
£205.52/ea £0.00
20 µgQM-0203473-03
20 µgQM-0203473-03
£288.14/ea
£0.00
£288.14/ea £0.00
50 µgQM-0203473-04
50 µgQM-0203473-04
£587.03/ea
£0.00
£587.03/ea £0.00
100 µgQM-0203473-05
100 µgQM-0203473-05
£913.87/ea
£0.00
£913.87/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Follistatin/FST, Mouse (HEK293, His)

Follistatin/FST, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.