Skip to product information
1 of 1

Janus kinase 2/JAK2, Human (His)

Janus kinase 2/JAK2, Human (His)

Size

SKU:QM-0197835-01

£140.00 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Janus kinase 2/JAK2 Protein, Human (His) is a recombinant human JAK2 expressed in E. coli with a His tag at the N-terminus. JAK2 is a non-receptor tyrosine kinase[1][2].

  • Molecular Formula

    3717 (Gene_ID) O60674-1 (S833-G1132) (Accession)

  • Smiles

    SGAFEDRDPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG

  • Purity

    95

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0197835-01
5 µgQM-0197835-01
£140.00/ea
£0.00
£140.00/ea £0.00
10 µgQM-0197835-02
10 µgQM-0197835-02
£241.46/ea
£0.00
£241.46/ea £0.00
50 µgQM-0197835-03
50 µgQM-0197835-03
£517.26/ea
£0.00
£517.26/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Janus kinase 2/JAK2, Human (His)

Janus kinase 2/JAK2, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.