1 1

LDHA, Mouse (HEK293, His)

LDHA, Mouse (HEK293, His)

Size

QM-0173898-01

£241.46 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    LDHA protein catalyzes the simultaneous and stereospecific interconversion of pyruvate and lactate, accompanied by the reciprocal interconversion of NADH and NAD (+) .LDHA Protein, Mouse (HEK293, His) is the recombinant mouse-derived LDHA protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    16828 (Gene_ID) P06151 (M1-F332) (Accession)

  • Smiles

    MATLKDQLIVNLLKEEQAPQNKITVVGVGAVGMACAISILMKDLADELALVDVMEDKLKGEMMDLQHGSLFLKTPKIVSSKDYCVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNIVKYSPHCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHALSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPELGTDADKEQWKEVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGINEDVFLSVPCILGQNGISDVVKVTLTPEEEARLKKSADTLWGIQKELQF

  • Purity

    98

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice
Learn more
Variant Variant total Quantity Price Variant total
10 µgQM-0173898-01
10 µgQM-0173898-01
£241.46/ea		 £0.00
£241.46/ea £0.00
50 µgQM-0173898-02
50 µgQM-0173898-02
£517.26/ea		 £0.00
£517.26/ea £0.00
100 µgQM-0173898-03
100 µgQM-0173898-03
£827.09/ea		 £0.00
£827.09/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

LDHA, Mouse (HEK293, His)

LDHA, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.