LDHA, Mouse (HEK293, His)
LDHA, Mouse (HEK293, His)
SKU:QM-0173898-01
Couldn't load pickup availability
Request quote or documents

Product Details
-
Description
LDHA protein catalyzes the simultaneous and stereospecific interconversion of pyruvate and lactate, accompanied by the reciprocal interconversion of NADH and NAD (+) .LDHA Protein, Mouse (HEK293, His) is the recombinant mouse-derived LDHA protein, expressed by HEK293 , with C-6*His labeled tag.
-
Molecular Formula
16828 (Gene_ID) P06151 (M1-F332) (Accession)
-
Smiles
MATLKDQLIVNLLKEEQAPQNKITVVGVGAVGMACAISILMKDLADELALVDVMEDKLKGEMMDLQHGSLFLKTPKIVSSKDYCVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNIVKYSPHCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHALSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPELGTDADKEQWKEVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGINEDVFLSVPCILGQNGISDVVKVTLTPEEEARLKKSADTLWGIQKELQF
-
Purity
98
-
Storage Conditions
Stored at -80°C for 1 year
-
Shipping Conditions
Dry ice
Related Products
- QM-0052850-01 Thio-TEPA-d12 [CAS 1276372-62-3]
- QM-0052841 β-Hyodeoxycholic acid-d4
- QM-0052354-01 ω-azido-C6 Ceramide [CAS 2108102-18-5]
- QM-0049861-01 Thionordiazepam [CAS 4547-02-8]
- QM-0023666 Trifunctional sphingosine [CAS 2089062-80-4]
- QM-0023654 Trifunctional fatty acid [CAS 2089043-73-0]
- QM-0023452-01 Tryptophan-cholic acid [CAS 1630745-39-9]
- QM-0017007 Telcagepant-d8 [CAS 1132641-75-8]
- QM-0016771 Tauroursocholic acid (sodium) [CAS 17515-36-5]
- QM-0014487 Thromboxane B2 ethanolamide [CAS 398138-29-9]
Other industry favorites
- QM-0052850-01 Thio-TEPA-d12 [CAS 1276372-62-3]
- QM-0052841 β-Hyodeoxycholic acid-d4
- QM-0144182-01 Vepafestinib [CAS 2129515-96-2]
- QM-0155900-01 Telcagepant [CAS 781649-09-0]
- QM-0130602 α-Muricholic acid (Standard) [CAS 2393-58-0]
- QM-0061226 Uredepa [CAS 302-49-8]
- QM-0003846 Ursocholic acid (Standard) [CAS 2955-27-3]
- QM-0140930-01 Ubrogepant [CAS 1374248-77-7]
- QM-0076452-01 ω-3 Arachidonic acid [CAS 24880-40-8]
- QM-0168772 Trihexosylceramide (d18:1/12:0) [CAS 474943-80-1]
LDHA, Mouse (HEK293, His)
LDHA, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.