1 1

Statherin, Human (HEK293, Fc)

Statherin, Human (HEK293, Fc)

Size

QM-0202556-01

£101.75 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    Statherin, a salivary protein, crucially regulates saliva's calcium salt supersaturation by inhibiting calcium phosphate salt precipitation. Beyond preventing crystallization, statherin significantly influences hydroxyapatite crystal formation on teeth, highlighting its dual role in dental health. It prevents undesirable mineral deposition and impacts tooth mineralization dynamics. Statherin Protein, Human (HEK293, Fc) is the recombinant human-derived Statherin protein, expressed by HEK293 , with C-mFc labeled tag.

  • Molecular Formula

    6779 (Gene_ID) P02808-1 (M1-F62) (Accession)

  • Smiles

    MKFLVFAFILALMVSMIGADSSEEKFLRRIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF

  • Purity

    95

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice
Learn more
Variant Variant total Quantity Price Variant total
5 µgQM-0202556-01
5 µgQM-0202556-01
£101.75/ea		 £0.00
£101.75/ea £0.00
10 µgQM-0202556-02
10 µgQM-0202556-02
£145.63/ea		 £0.00
£145.63/ea £0.00
20 µgQM-0202556-03
20 µgQM-0202556-03
£249.96/ea		 £0.00
£249.96/ea £0.00
50 µgQM-0202556-04
50 µgQM-0202556-04
£406.69/ea		 £0.00
£406.69/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

Statherin, Human (HEK293, Fc)

Statherin, Human (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.