1 1

Stathmin, Human (His)

Stathmin, Human (His)

Size

QM-0204675-01

£97.00 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    Stathmin Protein, a widely distributed cytosolic phosphoprotein, integrates regulatory signals and destabilizes microtubules, crucial for their assembly and disassembly. It exhibits broad expression in various tissues, highlighting its versatile role in cellular processes. Stathmin Protein, Human (His) is the recombinant human-derived Stathmin protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    3925 (Gene_ID) P16949-1/NP_981946.1 (M1-D149) (Accession)

  • Smiles

    MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD

  • Purity

    92.7

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
5 µgQM-0204675-01
5 µgQM-0204675-01
£97.00/ea		 £0.00
£97.00/ea £0.00
10 µgQM-0204675-02
10 µgQM-0204675-02
£147.63/ea		 £0.00
£147.63/ea £0.00
50 µgQM-0204675-03
50 µgQM-0204675-03
£448.52/ea		 £0.00
£448.52/ea £0.00
100 µgQM-0204675-04
100 µgQM-0204675-04
£714.61/ea		 £0.00
£714.61/ea £0.00
500 µgQM-0204675-05
500 µgQM-0204675-05
£1,908.95/ea		 £0.00
£1,908.95/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

Stathmin, Human (His)

Stathmin, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.