UDP-glucose 4-epimerase/GALE, Human (His)
UDP-glucose 4-epimerase/GALE, Human (His)
SKU:QM-0174566-01
Couldn't load pickup availability
Request quote or documents

Product Details
-
Description
GALE proteins catalyze the reversible epimerization of UDP-glucose to UDP-galactose, and the reversible epimerization of UDP-N-acetylglucosamine to UDP-N-acetylgalactosamine. UDP-glucose 4-epimerase/GALE Protein, Human (His) is the recombinant human-derived UDP-glucose 4-epimerase/GALE protein, expressed by E. coli , with N-6*His labeled tag.
-
Molecular Formula
2582 (Gene_ID) Q14376-1 (M1-A348) (Accession)
-
Smiles
MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA
-
Purity
98
-
Storage Conditions
Stored at -80°C for 1 year
-
Shipping Conditions
Dry ice.
Related Products
- QM-0084743-01 α-Lactose (hydrate) (Standard) [CAS 5989-81-1]
- QM-0077541-01 Sucrose (Standard) [CAS 57-50-1]
- QM-0120891-01 Fructose (Standard) [CAS 7660-25-5]
- QM-0053743-01 Tetragalacturonic acid [CAS 24008-75-1]
- QM-0047684-01 β-D-Galactosamine pentaacetate [CAS 3006-60-8]
- QM-0024503-01 Stachyose (Standard) [CAS 470-55-3]
- QM-0024289 Tsugaric acid A (Standard) [CAS 174391-64-1]
- QM-0005722 α, α-Trehalose 6-phosphate (potassium) (Standard) [CAS 136632-28-5]
- QM-0005256 Uridine diphosphate glucuronic acid-13C,15N2
- QM-0003944 Stachyose (tetrahydrate) (Standard) [CAS 10094-58-3]
Other industry favorites
- QM-0084743-01 α-Lactose (hydrate) (Standard) [CAS 5989-81-1]
- QM-0077541-01 Sucrose (Standard) [CAS 57-50-1]
- QM-0185745-01 Stachyose [CAS 470-55-3]
- QM-0143635-01 α, α-Trehalose 6-phosphate (potassium) [CAS 136632-28-5]
- QM-0057159 Trehalose 6-behenate [CAS 66755-19-9]
- QM-0089236 β, β-Trehalose [CAS 499-23-0]
- QM-0161330-01 UDP-sugar pyrophosphorylase (BlUSP) [CAS 223918-15-8]
- QM-0141693-01 Uridine diphosphate glucuronic acid (ammonium) [CAS 43195-60-4]
- QM-0111546-01 Trehalose 6,6′-dimycolate [CAS 61512-20-7]
- QM-0111345-01 Trehalose C12 [CAS 64622-91-9]
UDP-glucose 4-epimerase/GALE, Human (His)
UDP-glucose 4-epimerase/GALE, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.