Skip to product information
1 of 1

USP8, Human (sf9)

USP8, Human (sf9)

Size

SKU:QM-0135640-01

£534.27 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    USP8 is a key hydrolase in cellular regulation and plays a crucial role in protein turnover by efficiently deubiquitinating proteins and preventing degradation. Its activity spans "Lys-48" and "Lys-63" linked ubiquitin chains, highlighting its versatility. USP8 Protein, Human (sf9) is the recombinant human-derived USP8 protein, expressed by Sf9 insect cells, with tag free.

  • Molecular Formula

    9101 (Gene_ID) P40818-1 (P734-G1110) (Accession)

  • Smiles

    PTVTPTVNRENKPTCYPKAEISRLSASQIRNLNPVFGGSGPALTGLRNLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKALWTGQYRYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNDHLDDFKAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLASTSKCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDLSQYVIGPKNNLKKYNLFSVSNHYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVKSSAAYILFYTSLG

  • Purity

    98

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0135640-01
10 µgQM-0135640-01
£534.27/ea
£0.00
£534.27/ea £0.00
50 µgQM-0135640-02
50 µgQM-0135640-02
£1,231.68/ea
£0.00
£1,231.68/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

USP8, Human (sf9)

USP8, Human (sf9) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.