Skip to product information
1 of 1

USP8, Human (sf9, His, GST)

USP8, Human (sf9, His, GST)

Size

SKU:QM-0121763-01

£434.64 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    USP8 is a key hydrolase in cellular regulation and plays a crucial role in protein turnover by efficiently deubiquitinating proteins and preventing degradation. Its activity spans "Lys-48" and "Lys-63" linked ubiquitin chains, highlighting its versatility. USP8 Protein, Human (sf9, His, GST) is the recombinant human-derived USP8 protein, expressed by Sf9 insect cells, with N-His and N-GST labeled tag.

  • Molecular Formula

    9101 (Gene_ID) P40818-1 (P734-G1110) (Accession)

  • Smiles

    PTVTPTVNRENKPTCYPKAEISRLSASQIRNLNPVFGGSGPALTGLRNLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKALWTGQYRYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNDHLDDFKAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLASTSKCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDLSQYVIGPKNNLKKYNLFSVSNHYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVKSSAAYILFYTSLG

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0121763-01
10 µgQM-0121763-01
£434.64/ea
£0.00
£434.64/ea £0.00
50 µgQM-0121763-02
50 µgQM-0121763-02
£1,093.17/ea
£0.00
£1,093.17/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

USP8, Human (sf9, His, GST)

USP8, Human (sf9, His, GST) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.