Skip to product information
1 of 1

VEGFR-1, Human (328a.a, HEK293, Fc)

VEGFR-1, Human (328a.a, HEK293, Fc)

Size

SKU:QM-0097219

Price on request
Quantity

Request quote or documents

View full details
  • Description

    The VEGFR-1 protein is a tyrosine protein kinase that acts as a cell surface receptor for VEGFA, VEGFB, and PGF. It plays a crucial role in embryonic vasculature development, regulation of angiogenesis, cell survival, migration, macrophage function, chemotaxis, and cancer cell invasion. VEGFR-1 Protein, Human (328a.a, HEK293, Fc) is the recombinant human-derived VEGFR-1 protein, expressed by HEK293 , with C-hFc labeled tag.

  • Molecular Formula

    2321 (Gene_ID) P17948-4/NP_001153503.1 (S27-I328) (Accession)

  • Smiles

    MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSVHI

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0097219
1 EachQM-0097219
£0.00/ea
£0.00
£0.00/ea £0.00

VEGFR-1, Human (328a.a, HEK293, Fc)

VEGFR-1, Human (328a.a, HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.