Skip to product information
1 of 1

VEGFR-1, Human (328a.a, HEK293, His)

VEGFR-1, Human (328a.a, HEK293, His)

Size

SKU:QM-0202172-01

£126.50 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The VEGFR-1 protein is a tyrosine protein kinase that acts as a cell surface receptor for VEGFA, VEGFB, and PGF. It plays a crucial role in embryonic vasculature development, regulation of angiogenesis, cell survival, migration, macrophage function, chemotaxis, and cancer cell invasion. VEGFR-1 Protein, Human (328a.a, HEK293, His) is the recombinant human-derived VEGFR-1 protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    2321 (Gene_ID) P17948-4/NP_001153503.1 (S27-I328) (Accession)

  • Smiles

    MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSVHI

  • Purity

    98

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0202172-01
10 µgQM-0202172-01
£126.50/ea
£0.00
£126.50/ea £0.00
50 µgQM-0202172-02
50 µgQM-0202172-02
£296.13/ea
£0.00
£296.13/ea £0.00
100 µgQM-0202172-03
100 µgQM-0202172-03
£406.69/ea
£0.00
£406.69/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

VEGFR-1, Human (328a.a, HEK293, His)

VEGFR-1, Human (328a.a, HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.