1 1

Animal-Free Fas Ligand, Human (His)

Animal-Free Fas Ligand, Human (His)

Size

QM-0195264-01

£72.61 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    Fas Ligand (CD178; APTL) is a ligand to TNFRSF6/FAS/CD95, transduces the apoptotic signal to regulate cytotoxic T-cell-mediated apoptosis, natural killer cell-mediated apoptosis and in T-cell development[1]. Human Fas Ligand exhibits 4 isoforms, the soluble form (130-281 a.a.) of which plays an important role in the activation-induced cell death (AICD) of T lymphocytes Jurkat cells[3]. However the membrane-bound isoform could be responsible for its inflammatory activity[4]. Animal-Free Fas Ligand Protein, Human (His) has a total length of 152 amino acids (Q130-L281), is expressed in E. coli with N-terminal His-tag.This product is for cell culture use only.

  • Molecular Formula

    356 (Gene_ID) P48023-1 (Q130-L281) (Accession)

  • Smiles

    QIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
2 µgQM-0195264-01
2 µgQM-0195264-01
£72.61/ea		 £0.00
£72.61/ea £0.00
10 µgQM-0195264-02
10 µgQM-0195264-02
£210.38/ea		 £0.00
£210.38/ea £0.00
50 µgQM-0195264-03
50 µgQM-0195264-03
£492.26/ea		 £0.00
£492.26/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

Animal-Free Fas Ligand, Human (His)

Animal-Free Fas Ligand, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.