1 1

TRAILR4/TNFRSF10D, Rhesus Macaque (HEK293, His)

TRAILR4/TNFRSF10D, Rhesus Macaque (HEK293, His)

Size

QM-0203477-01

£52.94 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    TRAILR4/TNFRSF10D Protein , a receptor for TRAIL. Paradoxically, it not only fails to induce apoptosis but also protects against TRAIL-mediated apoptosis. Conflicting reports exist about its role in activating the NF-kappa-B pathway. The dual nature of TRAILR4 in interacting with TRAIL, both as a receptor and a protective factor, highlights the complexity of its regulatory functions in cellular responses to TRAIL signaling. TRAILR4/TNFRSF10D Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived TRAILR4/TNFRSF10D protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    716901 (Gene_ID) XP_001107922 (A56-L206) (Accession)

  • Smiles

    ATISRKDEVPLPPVASKQQRRSLEAECPAGFHRSEHTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNTSSCTTTRDTVCQCEKGSFQDANSPEMCRKCSTGCPRGMIKVSDCTPWSDINCSASAASSTGKTPAAEDTVPTSLGTPDL

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
2 µgQM-0203477-01
2 µgQM-0203477-01
£52.94/ea		 £0.00
£52.94/ea £0.00
10 µgQM-0203477-02
10 µgQM-0203477-02
£91.38/ea		 £0.00
£91.38/ea £0.00
50 µgQM-0203477-03
50 µgQM-0203477-03
£249.26/ea		 £0.00
£249.26/ea £0.00
100 µgQM-0203477-04
100 µgQM-0203477-04
£370.76/ea		 £0.00
£370.76/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

TRAILR4/TNFRSF10D, Rhesus Macaque (HEK293, His)

TRAILR4/TNFRSF10D, Rhesus Macaque (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.