Skip to product information
1 of 1

Animal-Free TRAIL/TNFSF10, Mouse (His)

Animal-Free TRAIL/TNFSF10, Mouse (His)

Size

SKU:QM-0198499-01

£104.88 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    TRAIL/TNFSF10 protein binds to TNFRSF10A, TNFRSF10B, TNFRSF10C, TNFRSF10D, and possibly TNFRSF11B, inducing apoptosis.It can be modulated by decoy receptors TNFRSF10C, TNFRSF10D, and TNFRSF11B, which do not induce apoptosis.TRAIL/TNFSF10 exists as a homotrimer, interacting with its receptor monomers.This complex molecular interaction governs apoptotic signaling pathways.Animal-Free TRAIL/TNFSF10 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeTRAIL/TNFSF10 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

  • Molecular Formula

    22035 (Gene_ID) P50592 (P118-N291) (Accession)

  • Smiles

    MPRGGRPQKVAAHITGITRRSNSALIPISKDGKTLGQKIESWESSRKGHSFLNHVLFRNGELVIEQEGLYYIYSQTYFRFQEAEDASKMVSKDKVRTKQLVQYIYKYTSYPDPIVLMKSARNSCWSRDAEYGLYSIYQGGLFELKKNDRIFVSVTNEHLMDLDQEASFFGAFLIN

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0198499-01
2 µgQM-0198499-01
£104.88/ea
£0.00
£104.88/ea £0.00
10 µgQM-0198499-02
10 µgQM-0198499-02
£291.78/ea
£0.00
£291.78/ea £0.00
50 µgQM-0198499-03
50 µgQM-0198499-03
£725.54/ea
£0.00
£725.54/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Animal-Free TRAIL/TNFSF10, Mouse (His)

Animal-Free TRAIL/TNFSF10, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.