Skip to product information
1 of 1

Bax, Human (His)

Bax, Human (His)

Size

SKU:QM-0027622-01

£111.63 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Bax Protein, Human (His) suppresses tumorigenesis and stimulates apoptosis. BCL2L4 (BAX) is the proapoptotic members of the Bcl-2 family that are ubiquitously expressed in different tissues[1][2][3].

  • Molecular Formula

    581 (Gene_ID) Q07812-1 (M1-Q171) (Accession)

  • Smiles

    MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQ

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0027622-01
5 µgQM-0027622-01
£111.63/ea
£0.00
£111.63/ea £0.00
10 µgQM-0027622-02
10 µgQM-0027622-02
£199.44/ea
£0.00
£199.44/ea £0.00
50 µgQM-0027622-03
50 µgQM-0027622-03
£437.58/ea
£0.00
£437.58/ea £0.00
100 µgQM-0027622-04
100 µgQM-0027622-04
£669.65/ea
£0.00
£669.65/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Bax, Human (His)

Bax, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.