1 1

Fas/CD95, Human

Fas/CD95, Human

Size

QM-0175681-01

£227.39 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    Fas receptor is a cell surface death receptor, can bind to Fas ligand to form death-inducing signaling complexes, such as Fas associated death domain proteins (FADD) [1][2]. Fas receptor participates in the caspase cascade and regulate the activation of JNK and p38-K downstream. It is also involved in the signaling cascade of ERK/JNK MAPKs, activating MAPK3/ERK1, MAPK8/JNK and NF-κB, which has been implicated in the pathogenesis of various malignant tumors and immune system diseases[3][4]. Human Fas receptor contain a death domain (230-314 a.a.) that plays a key role in regulating programmed death. Fas/CD95 Protein, Human has a full length of 157 amino acids (R17-N173), produced in E.coli with tag free.

  • Molecular Formula

    355 (Gene_ID) P25445 (R17-N173) (Accession)

  • Smiles

    RLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSN

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
10 µgQM-0175681-01
10 µgQM-0175681-01
£227.39/ea		 £0.00
£227.39/ea £0.00
50 µgQM-0175681-02
50 µgQM-0175681-02
£515.35/ea		 £0.00
£515.35/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

Fas/CD95, Human

Fas/CD95, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.