Fas/CD95, Rat (HEK293, Fc)
Fas/CD95, Rat (HEK293, Fc)
SKU:QM-0091217
Request quote or documents
Product Details
-
Description
Fas receptor is a cell surface death receptor, can bind to Fas ligand to form death-inducing signaling complexes, such as Fas associated death domain proteins (FADD) [1][2]. Fas receptor participates in the caspase cascade and regulate the activation of JNK and p38-K downstream. It is also involved in the signaling cascade of ERK/JNK MAPKs, activating MAPK3/ERK1, MAPK8/JNK and NF-κB, which has been implicated in the pathogenesis of various malignant tumors and immune system diseases[3][4]. Rat Fas receptor contain a death domain (219-303 a.a.) that plays a key role in regulating programmed death. Fas/CD95 Protein, Rat (HEK293, Fc) produced in HEK293 cells with C-terminal hFc tag.
-
Molecular Formula
246097 (Gene_ID) Q63199 (Q22-K170) (Accession)
-
Smiles
MLWIMAVLPLVLAGPELNVRMQGTDSIFEGLELKRSVRETDNNCSEGLYQVGPFCCQPCQPGERKVKDCTTSGGAPTCHPCTEGEEYTDRKHYSDKCRRCAFCDEGHGLEVETNCTRTQNTKCRCKENFYCNASLCDHCYHCTSCGLEDILEPCTRTSNTKCKKQSSNYK
-
Shipping Conditions
Dry ice.
Related Products
- QM-0044950 Usp53 Rat Pre-designed siRNA Set A
- QM-0038447 Usp53 Mouse Pre-designed siRNA Set A
- QM-0024946-01 Xelafaslatide [CAS 2040964-58-5]
- QM-0203477-01 TRAILR4/TNFRSF10D, Rhesus Macaque (HEK293, His)
- QM-0190917-01 Uricase, Bacillus fastidious [CAS 9002-12-4]
- QM-0161805-01 VF 647A-Annexin V-PI Apoptosis Detection Kit
- QM-0161804-01 TUNEL Apoptosis Detection Kit (Biotin)
- QM-0161802-01 VF 488 Caspase 3 Assay Kit for Live Cells
- QM-0170514-01 Yp537 (TFA)
- QM-0072134 VEGFR/PARP-IN-1 [CAS 3010256-54-6]
Other industry favorites
- QM-0044950 Usp53 Rat Pre-designed siRNA Set A
- QM-0038447 Usp53 Mouse Pre-designed siRNA Set A
- QM-0046523 Tp53inp1 Rat Pre-designed siRNA Set A
- QM-0044504 Parp9 Rat Pre-designed siRNA Set A
- QM-0148238-01 Rifasutenizol [CAS 1001314-13-1]
- QM-0169387-01 TRAIL/TNFSF10, Human (N-His)
- QM-0104587 Trp53 Mouse Pre-designed siRNA Set A
- QM-0096053 USP53, Human (His, GST)
- QM-0003208 Pibaxizine [CAS 82227-39-2]
- QM-0139807-01 PARPi-FL [CAS 1380359-84-1]
Fas/CD95, Rat (HEK293, Fc)
Fas/CD95, Rat (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.