Skip to product information
1 of 1

Fas Ligand, Human (HEK293, His)

Fas Ligand, Human (HEK293, His)

Size

SKU:QM-0027579-01

£52.94 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Fas Ligand (CD178; APTL) is a ligand to TNFRSF6/FAS/CD95, transduces the apoptotic signal to regulate cytotoxic T-cell-mediated apoptosis, natural killer cell-mediated apoptosis and in T-cell development[1]. Human Fas Ligand exhibits 4 isoforms, the soluble form (130-281 a.a.) of which plays an important role in the activation-induced cell death (AICD) of T lymphocytes Jurkat cells[3]. However the membrane-bound isoform could be responsible for its inflammatory activity[4]. Fas Ligand Protein, Human (HEK293, His) has a total length of 148 amino acids (P134-L281), is expressed in HEK392 cells with N-terminal 6*His-tag.

  • Molecular Formula

    356 (Gene_ID) P48023-1 (P134-L281) (Accession)

  • Smiles

    PSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0027579-01
2 µgQM-0027579-01
£52.94/ea
£0.00
£52.94/ea £0.00
10 µgQM-0027579-02
10 µgQM-0027579-02
£111.63/ea
£0.00
£111.63/ea £0.00
50 µgQM-0027579-03
50 µgQM-0027579-03
£305.15/ea
£0.00
£305.15/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Fas Ligand, Human (HEK293, His)

Fas Ligand, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.