Fas Ligand, Human (HEK293, His, solution)
Fas Ligand, Human (HEK293, His, solution)
SKU:QM-0176431-01
Couldn't load pickup availability
Request quote or documents
Product Details
-
Description
Fas Ligand (CD178; APTL) is a ligand to TNFRSF6/FAS/CD95, transduces the apoptotic signal to regulate cytotoxic T-cell-mediated apoptosis, natural killer cell-mediated apoptosis and in T-cell development[1]. Human Fas Ligand exhibits 4 isoforms, the soluble form (130-281 a.a.) of which plays an important role in the activation-induced cell death (AICD) of T lymphocytes Jurkat cells[3]. However the membrane-bound isoform could be responsible for its inflammatory activity[4]. Fas Ligand Protein, Human (HEK293, His, solution) has a total length of 148 amino acids (P134-L281), is expressed in HEK392 cells with N-terminal 6*His-tag.
-
Molecular Formula
356 (Gene_ID) P48023-1 (P134-L281) (Accession)
-
Smiles
PSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
-
Purity
98
-
Storage Conditions
Stored at -80°C for 1 year
-
Shipping Conditions
Dry ice.
Related Products
- QM-0044950 Usp53 Rat Pre-designed siRNA Set A
- QM-0038447 Usp53 Mouse Pre-designed siRNA Set A
- QM-0024946-01 Xelafaslatide [CAS 2040964-58-5]
- QM-0203477-01 TRAILR4/TNFRSF10D, Rhesus Macaque (HEK293, His)
- QM-0190917-01 Uricase, Bacillus fastidious [CAS 9002-12-4]
- QM-0161805-01 VF 647A-Annexin V-PI Apoptosis Detection Kit
- QM-0161804-01 TUNEL Apoptosis Detection Kit (Biotin)
- QM-0161802-01 VF 488 Caspase 3 Assay Kit for Live Cells
- QM-0170514-01 Yp537 (TFA)
- QM-0072134 VEGFR/PARP-IN-1 [CAS 3010256-54-6]
Other industry favorites
- QM-0044950 Usp53 Rat Pre-designed siRNA Set A
- QM-0038447 Usp53 Mouse Pre-designed siRNA Set A
- QM-0046523 Tp53inp1 Rat Pre-designed siRNA Set A
- QM-0044504 Parp9 Rat Pre-designed siRNA Set A
- QM-0148238-01 Rifasutenizol [CAS 1001314-13-1]
- QM-0169387-01 TRAIL/TNFSF10, Human (N-His)
- QM-0104587 Trp53 Mouse Pre-designed siRNA Set A
- QM-0096053 USP53, Human (His, GST)
- QM-0003208 Pibaxizine [CAS 82227-39-2]
- QM-0139807-01 PARPi-FL [CAS 1380359-84-1]
Fas Ligand, Human (HEK293, His, solution)
Fas Ligand, Human (HEK293, His, solution) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.