Skip to product information
1 of 1

Fas Ligand, Human (His)

Fas Ligand, Human (His)

Size

SKU:QM-0198613-01

£260.19 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    356 (Gene_ID) P48023-1 (Q103-L281) (Accession)

  • Smiles

    QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
20 µgQM-0198613-01
20 µgQM-0198613-01
£260.19/ea
£0.00
£260.19/ea £0.00
50 µgQM-0198613-02
50 µgQM-0198613-02
£454.60/ea
£0.00
£454.60/ea £0.00
100 µgQM-0198613-03
100 µgQM-0198613-03
£691.52/ea
£0.00
£691.52/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Fas Ligand, Human (His)

Fas Ligand, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.