1
/
of
1
Fas Ligand, Human (P.pastoris, His)
Fas Ligand, Human (P.pastoris, His)
SKU:QM-0167607
Price on request
Quantity
Request quote or documents
Product Details
-
Description
FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals. Fas Ligand Protein, Human (P.pastoris, His) is the recombinant human-derived FASLG protein, expressed by P. pastoris , with N-6*His labeled tag.
-
Molecular Formula
356 (Gene_ID) P48023-1 (Q103-L281) (Accession)
-
Smiles
QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
- QM-0044950 Usp53 Rat Pre-designed siRNA Set A
- QM-0038447 Usp53 Mouse Pre-designed siRNA Set A
- QM-0024946-01 Xelafaslatide [CAS 2040964-58-5]
- QM-0203477-01 TRAILR4/TNFRSF10D, Rhesus Macaque (HEK293, His)
- QM-0190917-01 Uricase, Bacillus fastidious [CAS 9002-12-4]
- QM-0161805-01 VF 647A-Annexin V-PI Apoptosis Detection Kit
- QM-0161804-01 TUNEL Apoptosis Detection Kit (Biotin)
- QM-0161802-01 VF 488 Caspase 3 Assay Kit for Live Cells
- QM-0170514-01 Yp537 (TFA)
- QM-0072134 VEGFR/PARP-IN-1 [CAS 3010256-54-6]
Other industry favorites
- QM-0044950 Usp53 Rat Pre-designed siRNA Set A
- QM-0038447 Usp53 Mouse Pre-designed siRNA Set A
- QM-0046523 Tp53inp1 Rat Pre-designed siRNA Set A
- QM-0044504 Parp9 Rat Pre-designed siRNA Set A
- QM-0148238-01 Rifasutenizol [CAS 1001314-13-1]
- QM-0169387-01 TRAIL/TNFSF10, Human (N-His)
- QM-0104587 Trp53 Mouse Pre-designed siRNA Set A
- QM-0096053 USP53, Human (His, GST)
- QM-0003208 Pibaxizine [CAS 82227-39-2]
- QM-0139807-01 PARPi-FL [CAS 1380359-84-1]
Fas Ligand, Human (P.pastoris, His)
Fas Ligand, Human (P.pastoris, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.