Skip to product information
1 of 1

TRAIL R2/TNFRSF10B, Human (HEK293)

TRAIL R2/TNFRSF10B, Human (HEK293)

Size

SKU:QM-0202838-01

£58.12 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    TRAIL R2/TNFRSF10B Protein, Human (HEK293) is a cell surface receptor of the TNF-receptor superfamily that binds TRAIL and mediates apoptosis.

  • Molecular Formula

    8795 (Gene_ID) O14763 (A54-E182) (Accession)

  • Smiles

    ALITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE

  • Purity

    96.06

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0202838-01
2 µgQM-0202838-01
£58.12/ea
£0.00
£58.12/ea £0.00
10 µgQM-0202838-02
10 µgQM-0202838-02
£74.68/ea
£0.00
£74.68/ea £0.00
50 µgQM-0202838-03
50 µgQM-0202838-03
£212.81/ea
£0.00
£212.81/ea £0.00
100 µgQM-0202838-04
100 µgQM-0202838-04
£327.02/ea
£0.00
£327.02/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

TRAIL R2/TNFRSF10B, Human (HEK293)

TRAIL R2/TNFRSF10B, Human (HEK293) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.