1 1

TRAIL R2/TNFRSF10B, Mouse (HEK293, hFc)

TRAIL R2/TNFRSF10B, Mouse (HEK293, hFc)

Size

QM-0205625-01

£58.12 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    TRAIL R2/TNFRSF10B protein is the receptor of TNFSF10/TRAIL and activates apoptosis through FADD-mediated recruitment of caspase-8 to form death-inducing signaling complex (DISC) .It initiates caspase cascade-mediated apoptosis and promotes NF-kappa-B activation, which is critical for ER stress-induced apoptosis.TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived TRAIL R2/TNFRSF10B protein, expressed by HEK293 , with C-hFc labeled tag.

  • Molecular Formula

    21933 (Gene_ID) Q9QZM4 (N53-S177) (Accession)

  • Smiles

    NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWAS

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
2 µgQM-0205625-01
2 µgQM-0205625-01
£58.12/ea		 £0.00
£58.12/ea £0.00
10 µgQM-0205625-02
10 µgQM-0205625-02
£81.92/ea		 £0.00
£81.92/ea £0.00
50 µgQM-0205625-03
50 µgQM-0205625-03
£227.39/ea		 £0.00
£227.39/ea £0.00
100 µgQM-0205625-04
100 µgQM-0205625-04
£316.08/ea		 £0.00
£316.08/ea £0.00
500 µgQM-0205625-05
500 µgQM-0205625-05
£990.41/ea		 £0.00
£990.41/ea £0.00
1 mgQM-0205625-06
1 mgQM-0205625-06
£1,765.58/ea		 £0.00
£1,765.58/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

TRAIL R2/TNFRSF10B, Mouse (HEK293, hFc)

TRAIL R2/TNFRSF10B, Mouse (HEK293, hFc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.