1 1

TRAIL/TNFSF10, Mouse (His)

TRAIL/TNFSF10, Mouse (His)

Size

QM-0200916-01

£58.12 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    TRAIL/TNFSF10 protein binds to TNFRSF10A, TNFRSF10B, TNFRSF10C, TNFRSF10D, and possibly TNFRSF11B, inducing apoptosis.It can be modulated by decoy receptors TNFRSF10C, TNFRSF10D, and TNFRSF11B, which do not induce apoptosis.TRAIL/TNFSF10 exists as a homotrimer, interacting with its receptor monomers.This complex molecular interaction governs apoptotic signaling pathways.TRAIL/TNFSF10 Protein, Mouse (His) is the recombinant mouse-derived TRAIL/TNFSF10 protein, expressed by E.coli , with N-6*His labeled tag.

  • Molecular Formula

    22035 (Gene_ID) P50592 (P118-N291) (Accession)

  • Smiles

    PRGGRPQKVAAHITGITRRSNSALIPISKDGKTLGQKIESWESSRKGHSFLNHVLFRNGELVIEQEGLYYIYSQTYFRFQEAEDASKMVSKDKVRTKQLVQYIYKYTSYPDPIVLMKSARNSCWSRDAEYGLYSIYQGGLFELKKNDRIFVSVTNEHLMDLDQEASFFGAFLIN

  • Purity

    97

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
2 µgQM-0200916-01
2 µgQM-0200916-01
£58.12/ea		 £0.00
£58.12/ea £0.00
10 µgQM-0200916-02
10 µgQM-0200916-02
£99.25/ea		 £0.00
£99.25/ea £0.00
50 µgQM-0200916-03
50 µgQM-0200916-03
£271.13/ea		 £0.00
£271.13/ea £0.00
100 µgQM-0200916-04
100 µgQM-0200916-04
£426.65/ea		 £0.00
£426.65/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

TRAIL/TNFSF10, Mouse (His)

TRAIL/TNFSF10, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.