Skip to product information
1 of 1

TRAILR4/TNFRSF10D, Human (HEK293, His)

TRAILR4/TNFRSF10D, Human (HEK293, His)

Size

SKU:QM-0193727-01

£52.94 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    TRAILR4/TNFRSF10D protein is a receptor for TRAIL and lacks the ability to induce apoptosis due to the truncated death domain. Paradoxically, not only does it fail to induce apoptosis, but it also prevents TRAIL-mediated apoptosis. TRAILR4/TNFRSF10D Protein, Human (HEK293, His) is the recombinant human-derived TRAILR4/TNFRSF10D protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    8793 (Gene_ID) Q9UBN6 (A56-H211) (Accession)

  • Smiles

    ATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKCKNESAASSTGKTPAAEETVTTILGMLASPYH

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0193727-01
5 µgQM-0193727-01
£52.94/ea
£0.00
£52.94/ea £0.00
10 µgQM-0193727-02
10 µgQM-0193727-02
£68.47/ea
£0.00
£68.47/ea £0.00
50 µgQM-0193727-03
50 µgQM-0193727-03
£147.63/ea
£0.00
£147.63/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

TRAILR4/TNFRSF10D, Human (HEK293, His)

TRAILR4/TNFRSF10D, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.