Vitamin D-binding/GC, Human (HEK293, His)
Vitamin D-binding/GC, Human (HEK293, His)
SKU:QM-0172586-01
Couldn't load pickup availability
Request quote or documents
Product Details
-
Description
GC protein is a multifunctional protein that promotes vitamin D transport and storage while scavenging extracellular G-actin to maintain cellular homeostasis. It enhances the chemotactic activity of C5 alpha toward neutrophils during inflammation, helps macrophage activation, and interacts with B lymphocyte and T lymphocyte membranes, indicating its involvement in the immune process. Vitamin D-binding protein/GC Protein, Human (HEK293, His) is the recombinant human-derived Vitamin D-binding protein/GC protein, expressed by HEK293 , with C-6*His labeled tag.
-
Molecular Formula
2638 (Gene_ID) P02774-1 (L17-L474) (Accession)
-
Smiles
LERGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKHSDFASNCCSINSPPLYCDSEIDAELKNIL
-
Purity
95
-
Storage Conditions
Stored at -20°C for 2 years
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
- QM-0120891-01 Fructose (Standard) [CAS 7660-25-5]
- QM-0077541-01 Sucrose (Standard) [CAS 57-50-1]
- QM-0084743-01 α-Lactose (hydrate) (Standard) [CAS 5989-81-1]
- QM-0054501-01 Saccharin-13C6 [CAS 1286479-01-3]
- QM-0054351 Xylitol-13C5
- QM-0050863 Tartaric acid (sodium hydrate) (Standard) [CAS 6131-98-2]
- QM-0049625 Theophylline impurity 9 (Standard) [CAS 42772-85-0]
- QM-0049624-01 Theophylline impurity 9 [CAS 42772-85-0]
- QM-0022127-01 Triacetylresveratrol (Standard) [CAS 42206-94-0]
- QM-0021671 Sucralose (GMP Like) [CAS 56038-13-2]
Other industry favorites
- QM-0120891-01 Fructose (Standard) [CAS 7660-25-5]
- QM-0077541-01 Sucrose (Standard) [CAS 57-50-1]
- QM-0136486-01 Tolebrutinib [CAS 1971920-73-6]
- QM-0137314-01 Saccharin 1-methylimidazole [CAS 482333-74-4]
- QM-0196192-01 Tyramine (hydrochloride) [CAS 60-19-5]
- QM-0194732-01 Rutin (trihydrate) [CAS 250249-75-3]
- QM-0005613 Theophylline (L-lysine) [CAS 83920-54-1]
- QM-0005105 Trimethylolmelamine [CAS 1017-56-7]
- QM-0162946-01 Sucralose [CAS 56038-13-2]
- QM-0200277-01 Tyramine (Standard) [CAS 51-67-2]
Vitamin D-binding/GC, Human (HEK293, His)
Vitamin D-binding/GC, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.