Animal-Free CD30 Ligand/TNFSF8, Human (His)
Animal-Free CD30 Ligand/TNFSF8, Human (His)
SKU:QM-0182736-01
Couldn't load pickup availability
Request quote or documents
Product Details
-
Description
CD30 ligand/TNFSF8 protein is a cytokine that specifically binds to TNFRSF8/CD30 and acts as a potent inducer of T cell proliferation. As a homotrimer, this ligand plays a crucial role in regulating T cell activation and growth, contributing to the dynamic coordination of immune responses. Animal-Free CD30 Ligand/TNFSF8 Protein, Human (His) is the recombinant human-derived animal-FreeCD30 Ligand/TNFSF8 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.
-
Molecular Formula
944 (Gene_ID) P32971 (Q63-D234) (Accession)
-
Smiles
MQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD
-
Purity
95
-
Storage Conditions
Stored at -20°C for 2 years
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
- QM-0025230 β-catenin inhibitory peptoid [CAS 2579070-02-1]
- QM-0023369 α-Synuclein inhibitor 14 [CAS 408324-13-0]
- QM-0015918 β2AR agonist 5 [CAS 2759727-47-2]
- QM-0015098 α2AR agonist 2 [CAS 719277-27-7]
- QM-0013035 α-Synuclein inhibitor 15 [CAS 414880-30-1]
- QM-0013016 αMβ2 integrin agonist-1
- QM-0013015-01 α5β1 integrin agonist-2
- QM-0013014 α4β1 antagonist-1
- QM-0012730-01 YTHDF2 ligand-1 [CAS 3093182-34-1]
- QM-0009574 α5-GABAA receptor modulator 1
Other industry favorites
- QM-0025230 β-catenin inhibitory peptoid [CAS 2579070-02-1]
- QM-0023369 α-Synuclein inhibitor 14 [CAS 408324-13-0]
- QM-0141339-01 δ-Secretase inhibitor 11 [CAS 842964-18-5]
- QM-0196447-01 α2β1 Integrin Ligand Peptide (TFA)
- QM-0065091 μ opioid receptor agonist 1 [CAS 2667632-83-7]
- QM-0070729 β-Catenin modulator-5 [CAS 902168-07-4]
- QM-0150540-01 β-FXR antagonist 1 [CAS 2295804-92-9]
- QM-0153508-01 α-Synuclein inhibitor 11
- QM-0122210 δ opioid receptor antagonist 1
- QM-0121938 α-Synuclein inhibitor 13
Animal-Free CD30 Ligand/TNFSF8, Human (His)
Animal-Free CD30 Ligand/TNFSF8, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.