CD30 Ligand/TNFSF8, Rat (HEK293, Fc)
CD30 Ligand/TNFSF8, Rat (HEK293, Fc)
SKU:QM-0174672-01
Couldn't load pickup availability
Request quote or documents
Product Details
-
Description
CD30 Ligand is a B cell surface antigen and a ligand for CD30 (TNFRSF8), playing an inhibitory role in CD40-mediated immunoglobulin class switching[1]. CD30 Ligand is also a a marker for Hodgkin lymphoma and related hematologic malignancies, involves in activation and functioning of the T cell-dependent immune system[2]. CD30 ligand is expressed by T and B lymphocytes, macrophages, and a variety of normal haematopoietic cells and derived tumours. CD30 ligand exerts pleiotropic effects on normal and malignant lymphoid cells, including death, differentiation, or cell division[3]. As for CD30 ligand in rat contains a transmembrane domain belonging to the tumor necrosis factor (TNF) family. CD30 Ligand/TNFSF8 Protein, Rat (HEK293, Fc) is 172 amino acids in length (Q66-D237) and is expressed in the HEK293 cells with a N-terminal hFc-tag.
-
Molecular Formula
683163 (Gene_ID) M0R3V3 (Q66-D237) (Accession)
-
Smiles
QKKDSTPKTTESVPLKGGNCSEDLLCTLKRTPSKKSWAYLQVSKHLNSAKLSWNQDGTIHGLVYQDGNLVVQFPGWYFIICQLQFLVQCSNHSMDLTLQLVINSKIKKQALVTVCESGVQGKNIYHNLSQFLLHYLQVNSTISVRVDNFQYVDTNTFPLDNVLSVFLYSSSD
-
Purity
92.8
-
Storage Conditions
Stored at -80°C for 1 year
-
Shipping Conditions
Dry ice.
Related Products
- QM-0025230 β-catenin inhibitory peptoid [CAS 2579070-02-1]
- QM-0023369 α-Synuclein inhibitor 14 [CAS 408324-13-0]
- QM-0015918 β2AR agonist 5 [CAS 2759727-47-2]
- QM-0015098 α2AR agonist 2 [CAS 719277-27-7]
- QM-0013035 α-Synuclein inhibitor 15 [CAS 414880-30-1]
- QM-0013016 αMβ2 integrin agonist-1
- QM-0013015-01 α5β1 integrin agonist-2
- QM-0013014 α4β1 antagonist-1
- QM-0012730-01 YTHDF2 ligand-1 [CAS 3093182-34-1]
- QM-0009574 α5-GABAA receptor modulator 1
Other industry favorites
- QM-0025230 β-catenin inhibitory peptoid [CAS 2579070-02-1]
- QM-0023369 α-Synuclein inhibitor 14 [CAS 408324-13-0]
- QM-0141339-01 δ-Secretase inhibitor 11 [CAS 842964-18-5]
- QM-0196447-01 α2β1 Integrin Ligand Peptide (TFA)
- QM-0065091 μ opioid receptor agonist 1 [CAS 2667632-83-7]
- QM-0070729 β-Catenin modulator-5 [CAS 902168-07-4]
- QM-0150540-01 β-FXR antagonist 1 [CAS 2295804-92-9]
- QM-0153508-01 α-Synuclein inhibitor 11
- QM-0122210 δ opioid receptor antagonist 1
- QM-0121938 α-Synuclein inhibitor 13
CD30 Ligand/TNFSF8, Rat (HEK293, Fc)
CD30 Ligand/TNFSF8, Rat (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.