Chemotaxis inhibitory, S. aureus (P.pastoris, His)
Chemotaxis inhibitory, S. aureus (P.pastoris, His)
SKU:QM-0087225
Request quote or documents

Product Details
-
Description
Chemotaxis Inhibitory Protein (CIP) strategically counters the host defense mechanisms, inhibiting reactions of human neutrophils and monocytes to complement anaphylatoxin C5a and fMLP. As a molecular sentinel, CIP directly engages with C5aR and FPR, obstructing calcium responses induced by C5a and fMLP. In this tactical intervention, CIP acts as a guardian, finessefully thwarting bacterium phagocytosis. Chemotaxis inhibitory Protein, S. aureus (P.pastoris, His) is the recombinant Staphylococcus aureus-derived Chemotaxis inhibitory protein, expressed by P. pastoris , with N-His labeled tag.
-
Molecular Formula
/ (Gene_ID) Q6GFB3 (F29-Y149) (Accession)
-
Smiles
FTFEPFPTNEEIESNKKMLEKEKAYKESFKNSGLPTTLGKLDERLRNYLKKGTKNSAQFEKMVILTENKGYYTVYLNTPLAEDRKNVELLGKMYKTYFFKKGESKSSYVINGPGKTNEYAY
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
- QM-0025230 β-catenin inhibitory peptoid [CAS 2579070-02-1]
- QM-0023369 α-Synuclein inhibitor 14 [CAS 408324-13-0]
- QM-0015918 β2AR agonist 5 [CAS 2759727-47-2]
- QM-0015098 α2AR agonist 2 [CAS 719277-27-7]
- QM-0013035 α-Synuclein inhibitor 15 [CAS 414880-30-1]
- QM-0013016 αMβ2 integrin agonist-1
- QM-0013015-01 α5β1 integrin agonist-2
- QM-0013014 α4β1 antagonist-1
- QM-0012730-01 YTHDF2 ligand-1 [CAS 3093182-34-1]
- QM-0009574 α5-GABAA receptor modulator 1
Other industry favorites
- QM-0025230 β-catenin inhibitory peptoid [CAS 2579070-02-1]
- QM-0023369 α-Synuclein inhibitor 14 [CAS 408324-13-0]
- QM-0141339-01 δ-Secretase inhibitor 11 [CAS 842964-18-5]
- QM-0196447-01 α2β1 Integrin Ligand Peptide (TFA)
- QM-0065091 μ opioid receptor agonist 1 [CAS 2667632-83-7]
- QM-0070729 β-Catenin modulator-5 [CAS 902168-07-4]
- QM-0150540-01 β-FXR antagonist 1 [CAS 2295804-92-9]
- QM-0153508-01 α-Synuclein inhibitor 11
- QM-0122210 δ opioid receptor antagonist 1
- QM-0121938 α-Synuclein inhibitor 13
Chemotaxis inhibitory, S. aureus (P.pastoris, His)
Chemotaxis inhibitory, S. aureus (P.pastoris, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.