1 1

Neuroserpin, Mouse (HEK293, His)

Neuroserpin, Mouse (HEK293, His)

Size

QM-0204489-01

£81.92 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    Neuroserpin is a serine protease inhibitor that significantly inhibits plasminogen activator and plasmin without affecting thrombin.In addition to their role in protease inhibition, neuroserine proteases contribute to synaptic plasticity, affecting synaptic connections in the adult nervous system.Neuroserpin Protein, Mouse (HEK293, His) is the recombinant mouse-derived Neuroserpin protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    20713 (Gene_ID) O35684 (T17-L410) (Accession)

  • Smiles

    TGATFPDETITEWSVNMYNHLRGTGEDENILFSPLSIALAMGMMELGAQGSTRKEIRHSMGYEGLKGGEEFSFLRDFSNMASAEENQYVMKLANSLFVQNGFHVNEEFLQMLKMYFNAEVNHVDFSQNVAVANSINKWVENYTNSLLKDLVSPEDFDGVTNLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLALSRQEVPLATLEPLLKAQLIEEWANSVKKQKVEVYLPRFTVEQEIDLKDILKALGVTEIFIKDANLTAMSDKKELFLSKAVHKSCIEVNEEGSEAAAASGMIAISRMAVLYPQVIVDHPFLYLIRNRKSGIILFMGRVMNPETMNTSGHDFEEL

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
5 µgQM-0204489-01
5 µgQM-0204489-01
£81.92/ea		 £0.00
£81.92/ea £0.00
10 µgQM-0204489-02
10 µgQM-0204489-02
£127.38/ea		 £0.00
£127.38/ea £0.00
50 µgQM-0204489-03
50 µgQM-0204489-03
£359.82/ea		 £0.00
£359.82/ea £0.00
100 µgQM-0204489-04
100 µgQM-0204489-04
£580.96/ea		 £0.00
£580.96/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

Neuroserpin, Mouse (HEK293, His)

Neuroserpin, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.