OX40 Ligand/TNFSF4, Cynomolgus/Rhesus Macaque (HEK293, His)
OX40 Ligand/TNFSF4, Cynomolgus/Rhesus Macaque (HEK293, His)
SKU:QM-0185379-01
Couldn't load pickup availability
Request quote or documents

Product Details
-
Description
OX40 Ligand (TNFSF4) is a type II glycoprotein with a cytoplasmic tail of 23 aa and an extracellular domain of 133 aa[1]. OX40 Ligand is a ligand for TNFRSF4 (CD134), belongs to tumor necrosis factor (TNF) family. OX40 Ligand can activate OX40 and thereby functioning as a T cell co-stimulatory molecule. The OX40-OX40 Ligand interaction promotes effector T-cell survival and effectively induces memory T-cell generation, as well as enhances the helper function of Tfh for B cells, and also promotes the differentiation and maturation of DCs[1][2]. OX40 Ligand/TNFSF4 Protein, Cynomolgus/Rhesus Macaque (HEK293, His) is a recombinant cynomolgus OX40 Ligand (Q51-L183) with N-terminal 8*His tag, which is produced in HEK293.
-
Molecular Formula
706255 (Gene_ID) F7FL80 (Q51-L183) /A0A2K5TTN0 (Q81-L213) (Accession)
-
Smiles
QVSHQYPRIQSIKVQFTEYKKEEGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
-
Purity
96.03
-
Storage Conditions
Stored at -20°C for 2 years
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
- QM-0025230 β-catenin inhibitory peptoid [CAS 2579070-02-1]
- QM-0023369 α-Synuclein inhibitor 14 [CAS 408324-13-0]
- QM-0015918 β2AR agonist 5 [CAS 2759727-47-2]
- QM-0015098 α2AR agonist 2 [CAS 719277-27-7]
- QM-0013035 α-Synuclein inhibitor 15 [CAS 414880-30-1]
- QM-0013016 αMβ2 integrin agonist-1
- QM-0013015-01 α5β1 integrin agonist-2
- QM-0013014 α4β1 antagonist-1
- QM-0012730-01 YTHDF2 ligand-1 [CAS 3093182-34-1]
- QM-0009574 α5-GABAA receptor modulator 1
Other industry favorites
- QM-0025230 β-catenin inhibitory peptoid [CAS 2579070-02-1]
- QM-0023369 α-Synuclein inhibitor 14 [CAS 408324-13-0]
- QM-0141339-01 δ-Secretase inhibitor 11 [CAS 842964-18-5]
- QM-0196447-01 α2β1 Integrin Ligand Peptide (TFA)
- QM-0065091 μ opioid receptor agonist 1 [CAS 2667632-83-7]
- QM-0070729 β-Catenin modulator-5 [CAS 902168-07-4]
- QM-0150540-01 β-FXR antagonist 1 [CAS 2295804-92-9]
- QM-0153508-01 α-Synuclein inhibitor 11
- QM-0122210 δ opioid receptor antagonist 1
- QM-0121938 α-Synuclein inhibitor 13
OX40 Ligand/TNFSF4, Cynomolgus/Rhesus Macaque (HEK293, His)
OX40 Ligand/TNFSF4, Cynomolgus/Rhesus Macaque (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.