1 1

OX40 Ligand/TNFSF4, Human (HEK293)

OX40 Ligand/TNFSF4, Human (HEK293)

Size

QM-0205825-01

£73.65 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    OX40 Ligand/TNFSF4 Protein is a cytokine that binds specifically to TNFRSF4 and acts as a potent T-cell co-stimulator when OX40 Ligand is expressed in trimer form, promoting proliferation and cytokine production. Interactions with TNFRSF4 contribute to complex regulation, which is essential for regulating T cell function and enabling effective and controlled immune activation. OX40 Ligand/TNFSF4 Protein, Human (HEK293) is the recombinant human-derived OX40 Ligand/TNFSF4 protein, expressed by HEK293, which is unlabeled and a monomeric protein.

  • Molecular Formula

    7292 (Gene_ID) P23510-1 (Q51-L183) (Accession)

  • Smiles

    QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
2 µgQM-0205825-01
2 µgQM-0205825-01
£73.65/ea		 £0.00
£73.65/ea £0.00
10 µgQM-0205825-02
10 µgQM-0205825-02
£199.44/ea		 £0.00
£199.44/ea £0.00
50 µgQM-0205825-03
50 µgQM-0205825-03
£437.58/ea		 £0.00
£437.58/ea £0.00
100 µgQM-0205825-04
100 µgQM-0205825-04
£669.65/ea		 £0.00
£669.65/ea £0.00
500 µgQM-0205825-05
500 µgQM-0205825-05
£1,377.99/ea		 £0.00
£1,377.99/ea £0.00
1 mgQM-0205825-06
1 mgQM-0205825-06
£2,153.16/ea		 £0.00
£2,153.16/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

OX40 Ligand/TNFSF4, Human (HEK293)

OX40 Ligand/TNFSF4, Human (HEK293) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.