Skip to product information
1 of 1

OX40 Ligand/TNFSF4, Mouse (HEK293, His)

OX40 Ligand/TNFSF4, Mouse (HEK293, His)

Size

SKU:QM-0190357-01

£207.95 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    OX40 Ligand (TNFSF4) is a type II glycoprotein with a cytoplasmic tail of 23 aa and an extracellular domain of 133 aa[1]. OX40 Ligand is a ligand for TNFRSF4 (CD134), belongs to tumor necrosis factor (TNF) family. OX40 Ligand can activate OX40 and thereby functioning as a T cell co-stimulatory molecule. The OX40-OX40 Ligand interaction promotes effector T-cell survival and effectively induces memory T-cell generation, as well as enhances the helper function of Tfh for B cells, and also promotes the differentiation and maturation of DCs[1][2]. OX40 Ligand/TNFSF4 Protein, Mouse (HEK293, His) is a recombinant mouse OX40 Ligand (S51-L198) with N-terminal 8*His tag, which is produced in HEK293.

  • Molecular Formula

    22164 (Gene_ID) P43488 (S51-L198) (Accession)

  • Smiles

    SSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL

  • Purity

    96.74

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0190357-01
10 µgQM-0190357-01
£207.95/ea
£0.00
£207.95/ea £0.00
50 µgQM-0190357-02
50 µgQM-0190357-02
£492.26/ea
£0.00
£492.26/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

OX40 Ligand/TNFSF4, Mouse (HEK293, His)

OX40 Ligand/TNFSF4, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.