Skip to product information
1 of 1

OX40 Ligand/TNFSF4, Rabbit (HEK293, hFc)

OX40 Ligand/TNFSF4, Rabbit (HEK293, hFc)

Size

SKU:QM-0092145

Price on request
Quantity

Request quote or documents

View full details
  • Description

    OX40 Ligand/TNFSF4 Protein, a cytokine, binds TNFRSF4, acting as a potent T-cell co-stimulator for proliferation and cytokine production. As a homotrimer, its pivotal interaction with TNFRSF4 enhances immune response by activating and expanding T-cells. This engagement contributes to intricate regulation, making OX40 Ligand a key mediator in modulating T-cell functions for effective and controlled immune activation. OX40 Ligand/TNFSF4 Protein, Rabbit (HEK293, hFc) is the recombinant Rabbit-derived OX40 Ligand/TNFSF4 protein, expressed by HEK293 , with C-hFc labeled tag.

  • Molecular Formula

    100008595 (Gene_ID) O02765 (Q45-P187) (Accession)

  • Smiles

    QHSHAPEVSLQYPPIENIMTQLQILTSHECEEDSFILPLQKRDGTMEVQNNSVVIQCDGFYLLSLKGYFSQEVSISLHYRKGEEPFPILKKTKFANSNVVLKLGYKDKVYLNVTTDSASCKQLSVNAGELIVILQNPGGYCAP

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0092145
1 EachQM-0092145
£0.00/ea
£0.00
£0.00/ea £0.00

OX40 Ligand/TNFSF4, Rabbit (HEK293, hFc)

OX40 Ligand/TNFSF4, Rabbit (HEK293, hFc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.