1 1

OX40 Ligand/TNFSF4, Rat (HEK293, Fc)

OX40 Ligand/TNFSF4, Rat (HEK293, Fc)

Size

QM-0203340-01

£61.22 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    OX40 Ligand (TNFSF4) is a type II glycoprotein with a cytoplasmic tail of 23 aa and an extracellular domain of 133 aa[1]. OX40 Ligand is a ligand for TNFRSF4 (CD134), belongs to tumor necrosis factor (TNF) family. OX40 Ligand can activate OX40 and thereby functioning as a T cell co-stimulatory molecule. The OX40-OX40 Ligand interaction promotes effector T-cell survival and effectively induces memory T-cell generation, as well as enhances the helper function of Tfh for B cells, and also promotes the differentiation and maturation of DCs[1][2]. OX40 Ligand/TNFSF4 Protein, Rat (HEK293, Fc) is a recombinant rat OX40 Ligand (V20-P210) with C-terminal hFc tag, which is produced in HEK293.

  • Molecular Formula

    25572 (Gene_ID) P15725 (V20-P210) (Accession)

  • Smiles

    VTVKLNCVKDTYPSGHKCCRECQPGHGMVSRCDHTRDTVCHPCEPGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTEDTVCQCRPGTQPRQDSSHKLGVDCVPCPPGHFSPGSNQACKPWTNCTLSGKQIRHPASNSLDTVCEDRSLLATLLWETQRTTFRPTTVPSTTVWPRTSQLPSTPTLVAPEGP

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
2 µgQM-0203340-01
2 µgQM-0203340-01
£61.22/ea		 £0.00
£61.22/ea £0.00
10 µgQM-0203340-02
10 µgQM-0203340-02
£134.13/ea		 £0.00
£134.13/ea £0.00
50 µgQM-0203340-03
50 µgQM-0203340-03
£381.69/ea		 £0.00
£381.69/ea £0.00
100 µgQM-0203340-04
100 µgQM-0203340-04
£614.98/ea		 £0.00
£614.98/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

OX40 Ligand/TNFSF4, Rat (HEK293, Fc)

OX40 Ligand/TNFSF4, Rat (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.