CDK2AP2, Human (HEK293, His)
CDK2AP2, Human (HEK293, His)
SKU:QM-0085179
Request quote or documents

Product Details
-
Description
The CDK2AP2 protein is an important component of the NuRD complex and actively participates in chromatin remodeling. It inhibits the G1/S phase transition by inhibiting CDK2 and preventing the interaction of CDK2 with cyclin E or A. CDK2AP2 Protein, Human (HEK293, His) is the recombinant human-derived CDK2AP2 protein, expressed by HEK293 , with C-6*His labeled tag.
-
Molecular Formula
10263 (Gene_ID) O75956 (M1-T126) (Accession)
-
Smiles
MSYKPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
- QM-0054937 Tubulin polymerization-IN-74 [CAS 54491-43-9]
- QM-0016949-01 Tubulin polymerization-IN-75 [CAS 5325-66-6]
- QM-0015976 Tubulin-IN-62
- QM-0015963 Tubulin polymerization-IN-84 [CAS 2982893-14-9]
- QM-0015797 Tubulin-IN-61
- QM-0015796 Tubulin-IN-60
- QM-0015606 Tubulin-IN-59
- QM-0015240 Tubulin polymerization/P-gp-IN-1
- QM-0015176 Tubulin-IN-58
- QM-0015147 Tubulin-IN-57
Other industry favorites
- QM-0054937 Tubulin polymerization-IN-74 [CAS 54491-43-9]
- QM-0016949-01 Tubulin polymerization-IN-75 [CAS 5325-66-6]
- QM-0013259 Tubulin-IN-54
- QM-0013216 Tubulin-IN-53
- QM-0161799-01 VF 594 Click-iT EdU Universal Cell Proliferation Detection Kit
- QM-0161801-01 VF 488 Click-iT EdU Universal Cell Proliferation Detection Kit
- QM-0013784 Tubulin/LSD1-IN-1
- QM-0013695 Tubulin polymerization-IN-80
- QM-0151970-01 Tubulin/JAK2-IN-1 [CAS 2933938-46-4]
- QM-0151842-01 Tubulin polymerization-IN-47 [CAS 2834087-62-4]
CDK2AP2, Human (HEK293, His)
CDK2AP2, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.