Skip to product information
1 of 1

CDK4, Human (sf9, His, Avi)

CDK4, Human (sf9, His, Avi)

Size

SKU:QM-0186795-01

£384.82 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    CDK4 protein, acting as a Ser/Thr kinase in the cyclin D-CDK4 complex, critically regulates the G (1) /S transition by phosphorylating and inhibiting RB family members. This activity, specifically hypophosphorylation of RB1 during early G (1) phase, releases E2F and promotes transcription of genes that drive G (1) progression. CDK4 Protein, Human (sf9, His, Avi) is the recombinant human-derived CDK4, expressed by Sf9 insect cells, with N-Avi, N-His labeled tag. The total length of CDK4 Protein, Human (sf9, His, Avi) is 303 a.a..

  • Molecular Formula

    1019 (Gene_ID) P11802-1 (M1-E303) (Accession)

  • Smiles

    MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE

  • Purity

    90.5

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0186795-01
10 µgQM-0186795-01
£384.82/ea
£0.00
£384.82/ea £0.00
50 µgQM-0186795-02
50 µgQM-0186795-02
£943.73/ea
£0.00
£943.73/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CDK4, Human (sf9, His, Avi)

CDK4, Human (sf9, His, Avi) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.