Skip to product information
1 of 1

CDK5, Human (P.pastoris, His)

CDK5, Human (P.pastoris, His)

Size

SKU:QM-0196834-01

£61.22 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    CDK5 is a proline-directed serine/threonine protein kinase that critically regulates neuronal cell cycle, differentiation and potential apoptosis in neuronal diseases by preventing cell cycle re-entry. It interacts with numerous proteins involved in neuronal development and coordinates processes such as survival, migration, differentiation, axonal growth, synaptogenesis, and neurotransmission. CDK5 Protein, Human (P.pastoris, His) is the recombinant human-derived CDK5 protein, expressed by P. pastoris , with N-His labeled tag.

  • Molecular Formula

    1020 (Gene_ID) Q00535 (M1-P292) (Accession)

  • Smiles

    MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0196834-01
2 µgQM-0196834-01
£61.22/ea
£0.00
£61.22/ea £0.00
10 µgQM-0196834-02
10 µgQM-0196834-02
£133.00/ea
£0.00
£133.00/ea £0.00
50 µgQM-0196834-03
50 µgQM-0196834-03
£370.76/ea
£0.00
£370.76/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CDK5, Human (P.pastoris, His)

CDK5, Human (P.pastoris, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.